Mental Fitness

1. Reduce Stress 

2. Get rid of Depression

3. Remain Healthy

Posters-3
“Vyadhi-styan-samsay-pramadalasya-avirati-branti-darshan-albdhbhumikatva-anavasthitatvanicitta-vikshepastentarayah”

Vyadhi= ailment, Styan = dullness, Samsay = doubt, Pramad = carelessness,
Alasya = laziness, Avirati = craving, Branti–darshan = delusion,
Alabdhabhumikatva = not achievement of a stage,
Anavasthitatvani=unsteadiness or instability of mind.

In this Sutra, Patanjali Mahamuni gives a number of conditions which cause the distraction of the mind and they are obstacles in improvement of a human being. He tells us about The Rajyog. Raj is mind as mind is the king of a human body. It has lot of controls of the general well being of a person.

The solution lies in Asan-Pranayam and meditation. Some relaxing postures will certainly help to calm down the body and mind. The postures take your awareness within to understand where things are going wrong. You have to go to the root cause of the problem. Then only you can rectify the same by teaching your own mind. In this field no one can help you but you yourself need to train your mind and overcome the conditions. Your mind is your mind, no one can enter it. So be strong and tackle it yourself. Regular practice of asan- Pranayam-meditation will definitely help you. But that is possible only with positive thinking.

Experience this yourself

• By attending regular batches at Shubh Yoga Kendra,
• Refer the Relaxed postures given in the reference Book for Heart, Asthma, Diabetes and Hypertension.
• Practice Shavasan regularly from the same book & with the pen drive.
• Listen to the lecture of “Pranayam” pen drive of 2 hours.
• Read Pranayam Book before you practice the 10 easy Pranayam Kriyas with the pen drive.
• Practice with the pen drive“Relieve from the stress”.

Remain Healthy to get Mental Fitness

There are several traditional asanas (postures) which keep all the big and small joints of the human body in a normal and healthy condition. Our muscles have property to stretch and contract. Many of them work in pairs to accommodate all proper or improper movements carried out by a human body.

When you practice different postures they strengthen different group of muscles with self weight. There are standing, sitting, forward/backward bending, twisting, inverted and relaxing postures. You should practice them in a proper sequence. Even Suryanamaskar given under Reduce Weight is a good sequence of postures. Practice few PranayamKriya. All the Yoga postures practiced in a sequence regularly bring flexibility in the body. And you feel experience the lightness in the body.

The cleaning of the body and mind takes place, which makes you aware of the inside of the body. Keep your diet and daily routine under control.

Experience this yourself

  • By practicing traditional postures from the Reference books
  • By practicing  the Health Energy Peace each day workout for a week on You tube Channel .
  • Practice easy 10 Pranayam Kriyas with the  PranayamKriya on Youtube Channel.
Shopping Cart